PDB entry 1yrw

View 1yrw on RCSB PDB site
Description: Crystal Structure of E.coli ArnA Transformylase Domain
Class: Transferase
Keywords: Rossmann fold; OB-like fold, Transferase
Deposited on 2005-02-04, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein ArnA
    Species: Escherichia coli [TaxId:562]
    Gene: YfbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yrwa1, d1yrwa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrwA (A:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    pg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrwA (A:)
    mktvvfayhdmgclgieallaagyeisaifthtdfygsvarlaaergipvyapdnvnhpl
    wveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvnget
    etgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnil
    eiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssr
    vhpkaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq