PDB entry 1yrv

View 1yrv on RCSB PDB site
Description: Novel Ubiquitin-Conjugating Enzyme
Class: ligase
Keywords: structural genomics consortium; sgc; ubiquitin; ubiquitin-conjugating enzyme; ligase, ligase
Deposited on 2005-02-04, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.244
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating ligase MGC351130
    Species: Homo sapiens [TaxId:9606]
    Gene: MGC35130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VVX9 (19-End)
      • expression tag (14-18)
    Domains in SCOPe 2.07: d1yrva1, d1yrva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrvA (A:)
    mgsshhhhhhssglvprgsmhgraylllhrdfcdlkennykgitakpvsedmmeweveie
    glqnsvwqglvfqltihftseynyappvvkfitipfhpnvdphtgqpcidfldnpekwnt
    nytlssillalqvmlsnpvlenpvnleaarilvkdeslyrtilrlfnrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrvA (A:)
    vprgsmhgraylllhrdfcdlkennykgitakpvsedmmeweveieglqnsvwqglvfql
    tihftseynyappvvkfitipfhpnvdphtgqpcidfldnpekwntnytlssillalqvm
    lsnpvlenpvnleaarilvkdeslyrtilrlfn