PDB entry 1yrt

View 1yrt on RCSB PDB site
Description: Crystal Structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of Bordetella pertussis in presence of c-terminal calmodulin
Class: layse, toxin
Keywords: CyaA, CaM, LAYSE, TOXIN
Deposited on 2005-02-04, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bifunctional hemolysin-adenylate cyclase
  Species: Bordetella pertussis [TaxId:520]
  Gene: cya, cyaA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15318 (Start-363)
• Chain 'B':
  Compound: calmodulin
  Species: Homo sapiens [TaxId:9606]
  Gene: calm1, calm2, calm3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62158
  Domains in SCOPe 2.07: d1yrtb_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1yrtB (B:)
  kmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdg
  qvnyeefvqmmtak
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1yrtB (B:)
  tdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny
  eefvqmmta