PDB entry 1yrt

View 1yrt on RCSB PDB site
Description: Crystal Structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of Bordetella pertussis in presence of c-terminal calmodulin
Class: layse, toxin
Keywords: CyaA, CaM, LAYSE, TOXIN
Deposited on 2005-02-04, released 2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional hemolysin-adenylate cyclase
    Species: Bordetella pertussis [TaxId:520]
    Gene: cya, cyaA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: calm1, calm2, calm3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yrtb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrtB (B:)
    kmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdg
    qvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrtB (B:)
    tdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny
    eefvqmmta