PDB entry 1yrs

View 1yrs on RCSB PDB site
Description: Crystal structure of KSP in complex with inhibitor 1
Class: cell cycle
Keywords: cell cycle
Deposited on 2005-02-04, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.25
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrsa_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrsb_
  • Heterogens: MG, ADP, L47, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrsA (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrsA (A:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrsB (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrsB (B:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk