PDB entry 1yrr

View 1yrr on RCSB PDB site
Description: Crystal Structure Of The N-Acetylglucosamine-6-Phosphate Deacetylase From Escherichia Coli K12 at 2.0 A Resolution
Class: hydrolase
Keywords: (beta/alpha)8 barrel, beta sandwich, hydrolase
Deposited on 2005-02-04, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Escherichia coli [TaxId:562]
    Gene: nagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrra1, d1yrra2
  • Chain 'B':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Escherichia coli [TaxId:562]
    Gene: nagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrrb1, d1yrrb2
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrrA (A:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcv
    dengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanl
    taftpdfkitktivngnevvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrrA (A:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkthnpnfvrkpdaalvdflcenadvitkvtlapemvpaevi
    sklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildeadi
    ycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcvd
    engtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanlt
    aftpdfkitktivngnevvtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrrB (B:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcv
    dengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanl
    taftpdfkitktivngnevvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrrB (B:)
    yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvqln
    gcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylakh
    pnqalglhlegpwlnaalvdflcenadvitkvtlapemvpaevisklanagivvsaghsn
    atlkeakagfragitfathlynampyitgrepglagaildeadiycgiiadglhvdyani
    rnakrlkgdklclvtdatsgssltmiegvrnlvehcgialdevlrmatlyparaigvekr
    lgtlaagkvanltaftpdfkitktivngnevvtq