PDB entry 1yrq

View 1yrq on RCSB PDB site
Description: Structure of the ready oxidized form of [NiFe]-hydrogenase
Class: oxidoreductase
Keywords: NiB state, hydroxide bridge, Oxidoreductase
Deposited on 2005-02-04, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic [NiFe] hydrogenase Small subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18187 (Start-263)
      • conflict (170)
    Domains in SCOPe 2.08: d1yrqa_
  • Chain 'B':
    Compound: Periplasmic [NiFe] hydrogenase Small subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18187 (Start-263)
      • conflict (170)
    Domains in SCOPe 2.08: d1yrqb_
  • Chain 'C':
    Compound: Periplasmic [NiFe] hydrogenase Small subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18187 (Start-263)
      • conflict (170)
    Domains in SCOPe 2.08: d1yrqc_
  • Chain 'D':
    Compound: Periplasmic [NiFe] hydrogenase Small subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18187 (Start-263)
      • conflict (170)
    Domains in SCOPe 2.08: d1yrqd_
  • Chain 'F':
    Compound: Periplasmic [NiFe] hydrogenase Small subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18187 (Start-263)
      • conflict (170)
    Domains in SCOPe 2.08: d1yrqf_
  • Chain 'G':
    Compound: Periplasmic [NiFe] hydrogenase Small subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18187 (Start-263)
      • conflict (170)
    Domains in SCOPe 2.08: d1yrqg_
  • Chain 'H':
    Compound: Periplasmic [NiFe] hydrogenase Large subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18188 (Start-548)
      • conflict (197)
      • conflict (302)
    Domains in SCOPe 2.08: d1yrqh_
  • Chain 'I':
    Compound: Periplasmic [NiFe] hydrogenase Large subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18188 (Start-548)
      • conflict (197)
      • conflict (302)
    Domains in SCOPe 2.08: d1yrqi_
  • Chain 'J':
    Compound: Periplasmic [NiFe] hydrogenase Large subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18188 (Start-548)
      • conflict (197)
      • conflict (302)
    Domains in SCOPe 2.08: d1yrqj_
  • Chain 'K':
    Compound: Periplasmic [NiFe] hydrogenase Large subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18188 (Start-548)
      • conflict (197)
      • conflict (302)
    Domains in SCOPe 2.08: d1yrqk_
  • Chain 'M':
    Compound: Periplasmic [NiFe] hydrogenase Large subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18188 (Start-548)
      • conflict (197)
      • conflict (302)
    Domains in SCOPe 2.08: d1yrqm_
  • Chain 'N':
    Compound: Periplasmic [NiFe] hydrogenase Large subunit
    Species: Desulfovibrio fructosovorans [TaxId:878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18188 (Start-548)
      • conflict (197)
      • conflict (302)
    Domains in SCOPe 2.08: d1yrqn_
  • Heterogens: SF4, F3S, NI, MG, FCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrqA (A:)
    ltakhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaal
    hqalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggv
    qkakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfyg
    elvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvq
    aghpclgcsepdfwdtmtpfyeqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqA (A:)
    akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
    alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
    akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfygel
    vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
    hpclgcsepdfwdtmtpfyeqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrqB (B:)
    ltakhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaal
    hqalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggv
    qkakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfyg
    elvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvq
    aghpclgcsepdfwdtmtpfyeqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqB (B:)
    akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
    alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
    akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfygel
    vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
    hpclgcsepdfwdtmtpfyeqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yrqC (C:)
    ltakhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaal
    hqalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggv
    qkakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfyg
    elvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvq
    aghpclgcsepdfwdtmtpfyeqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqC (C:)
    hrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhqal
    egkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqkak
    pnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfygelvh
    dncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqaghp
    clgcsepdfwdtmtpfyeqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yrqD (D:)
    ltakhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaal
    hqalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggv
    qkakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfyg
    elvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvq
    aghpclgcsepdfwdtmtpfyeqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqD (D:)
    akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
    alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
    akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfygel
    vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
    hpclgcsepdfwdtmtpfyeqg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yrqF (F:)
    ltakhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaal
    hqalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggv
    qkakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfyg
    elvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvq
    aghpclgcsepdfwdtmtpfyeqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqF (F:)
    hrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhqal
    egkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqkak
    pnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfygelvh
    dncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqaghp
    clgcsepdfwdtmtpfyeqg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yrqG (G:)
    ltakhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaal
    hqalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggv
    qkakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfyg
    elvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvq
    aghpclgcsepdfwdtmtpfyeqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqG (G:)
    akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
    alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
    akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfygel
    vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
    hpclgcsepdfwdtmtpfyeqg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yrqH (H:)
    maeskptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrd
    prdaqhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfy
    hlhaldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgift
    nayflgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsny
    qgltkdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatdds
    spskhlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkyt
    klddkdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhs
    tlgrtaargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgals
    hwirikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhaf
    dpciacgvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqH (H:)
    kptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrdprda
    qhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfyhlha
    ldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgiftnayf
    lgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsnyqglt
    kdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatddsspsk
    hlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkytkldd
    kdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhstlgr
    taargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgalshwir
    ikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhafdpci
    acgvh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yrqI (I:)
    maeskptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrd
    prdaqhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfy
    hlhaldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgift
    nayflgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsny
    qgltkdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatdds
    spskhlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkyt
    klddkdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhs
    tlgrtaargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgals
    hwirikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhaf
    dpciacgvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqI (I:)
    kptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrdprda
    qhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfyhlha
    ldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgiftnayf
    lgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsnyqglt
    kdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatddsspsk
    hlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkytkldd
    kdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhstlgr
    taargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgalshwir
    ikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhafdpci
    acgvh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1yrqJ (J:)
    maeskptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrd
    prdaqhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfy
    hlhaldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgift
    nayflgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsny
    qgltkdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatdds
    spskhlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkyt
    klddkdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhs
    tlgrtaargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgals
    hwirikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhaf
    dpciacgvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqJ (J:)
    ptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrdprdaq
    hftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfyhlhal
    dwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgiftnayfl
    gghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsnyqgltk
    dplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatddsspskh
    latsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkytklddk
    dhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhstlgrt
    aargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgalshwiri
    kgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhafdpcia
    cgvh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1yrqK (K:)
    maeskptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrd
    prdaqhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfy
    hlhaldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgift
    nayflgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsny
    qgltkdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatdds
    spskhlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkyt
    klddkdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhs
    tlgrtaargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgals
    hwirikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhaf
    dpciacgvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqK (K:)
    ptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrdprdaq
    hftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfyhlhal
    dwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgiftnayfl
    gghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsnyqgltk
    dplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatddsspskh
    latsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkytklddk
    dhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhstlgrt
    aargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgalshwiri
    kgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhafdpcia
    cgvh
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1yrqM (M:)
    maeskptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrd
    prdaqhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfy
    hlhaldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgift
    nayflgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsny
    qgltkdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatdds
    spskhlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkyt
    klddkdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhs
    tlgrtaargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgals
    hwirikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhaf
    dpciacgvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqM (M:)
    kptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrdprda
    qhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfyhlha
    ldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgiftnayf
    lgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsnyqglt
    kdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatddsspsk
    hlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkytkldd
    kdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhstlgr
    taargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgalshwir
    ikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhafdpci
    acgvh
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1yrqN (N:)
    maeskptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrd
    prdaqhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfy
    hlhaldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgift
    nayflgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsny
    qgltkdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatdds
    spskhlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkyt
    klddkdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhs
    tlgrtaargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgals
    hwirikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhaf
    dpciacgvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrqN (N:)
    kptpqstftgpivvdpitrieghlrimvevengkvkdawsssqlfrgleiilkgrdprda
    qhftqracgvctyvhalassrcvddavkvsipanarmmrnlvmasqylhdhlvhfyhlha
    ldwvdvtaalkadpnkaaklaasiaparpgnsakalkavqdklkafvesgqlgiftnayf
    lgghkayylppevnliatahylealhmqvkaasamailggknphtqftvvggcsnyqglt
    kdplanylalskevcqfvnecyipdllavagfykdwggiggtsnylafgefatddsspsk
    hlatsqfpsgvitgrdlgkvdnvdlgaiyedvkyswyapggdgkhpydgvtdpkytkldd
    kdhyswmkaprykgkamevgplartfiayakgqpdfkkvvdmvlgklsvpatalhstlgr
    taargietaivcanmekwikemadsgakdntlcakwempeeskgvgladaprgalshwir
    ikgkkidnfqlvvpstwnlgprgaqgdkspveealigtpiadpkrpveilrtvhafdpci
    acgvh