PDB entry 1yrn

View 1yrn on RCSB PDB site
Description: crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
Deposited on 1995-11-02, released 1996-01-29
The last revision prior to the SCOP 1.61 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1yrna_
  • Chain 'B':
    Domains in SCOP 1.61: d1yrnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yrnA (A:)
    ispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yrnB (B:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
    ktitiapeladllsgepl