PDB entry 1yrn

View 1yrn on RCSB PDB site
Description: crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to DNA
Class: DNA binding protein/DNA
Keywords: complex, DNA-binding protein, DNA, DNA binding protein/DNA complex
Deposited on 1995-11-02, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mat a1 homeodomain)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAT A1 RESIDUE 66-126
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrna_
  • Chain 'B':
    Compound: protein (mat alpha2 homeodomain)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAT ALPHA2 RESIDUE 128-210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrnb_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*cp*ap*tp*gp*tp*ap*ap*tp*tp*tp*ap*tp*tp*ap*c p*ap*tp*cp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*tp*gp*ap*tp*gp*tp*ap*ap*tp*ap*ap*ap*tp*tp*a p*cp*ap*tp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrnA (A:)
    kkekspkgkssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrnA (A:)
    ispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrnB (B:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
    ktitiapeladllsgeplakkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrnB (B:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
    ktitiapeladllsgepl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.