PDB entry 1yrl

View 1yrl on RCSB PDB site
Description: escherichia coli ketol-acid reductoisomerase
Deposited on 2005-02-04, released 2005-10-11
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketol-acid reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: ilvC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ketol-acid reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: ilvC
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ketol-acid reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: ilvC
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ketol-acid reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: ilvC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yrlA (A:)
    manyfntlnlrqqlaqlgkcrfmgrdefadgasylqgkkvvivgcgaqglnqglnmrdsg
    ldisyalrkeaiaekraswrkatengfkvgtyeelipqadlvinltpdkqhsdvvrtvqp
    lmkdgaalgyshgfnivevgeqirkditvvmvapkcpgtevreeykrgfgvptliavhpe
    ndpkgegmaiakawaaatgghragvlessfvaevksdlmgeqtilcgmlqagsllcfdkl
    veegtdpayaekliqfgwetitealkqggitlmmdrlsnpaklrayalseqlkeimaplf
    qkhmddiisgefssgmmadwanddkklltwreetgktafetapqyegkigeqeyfdkgvl
    miamvkagvelafetmvdsgiieesayyeslhelpliantiarkrlyemnvvisdtaeyg
    nylfsyacvpllkpfmaelqpgdlgkaipegavdngqlrdvneairshaieqvgkklrgy
    mtdmkriavag
    

    Sequence, based on observed residues (ATOM records):
    >1yrlA (A:)
    nyfntlnlrqqlaqlgkcrfmgrdefadgasylqgkkvvivgcgaqglnqglnmrdsgld
    isyalrkeaiaekraswrkatengfkvgtyeelipqadlvinltpdkqhsdvvrtvqplm
    kdgaalgyshgfnivevgeqirkditvvmvapkcpgtevreeykrgfgvptliavhpend
    pkgegmaiakawaaatgghragvlessfvaevksdlmgeqtilcgmlqagsllcfdklve
    egtdpayaekliqfgwetitealkqggitlmmdrlsnpaklrayalseqlkeimaplfqk
    hmddiisgefssgmmadwanddkklltwreetgktafetapqyegkigeqeyfdkgvlmi
    amvkagvelafetmvdsgiieesayyeslhelpliantiarkrlyemnvvisdtaeygny
    lfsyacvpllkpfmaelqpgdlgkaipegavdngqlrdvneairshaieqvgkklrgymt
    dmkriav
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yrlB (B:)
    manyfntlnlrqqlaqlgkcrfmgrdefadgasylqgkkvvivgcgaqglnqglnmrdsg
    ldisyalrkeaiaekraswrkatengfkvgtyeelipqadlvinltpdkqhsdvvrtvqp
    lmkdgaalgyshgfnivevgeqirkditvvmvapkcpgtevreeykrgfgvptliavhpe
    ndpkgegmaiakawaaatgghragvlessfvaevksdlmgeqtilcgmlqagsllcfdkl
    veegtdpayaekliqfgwetitealkqggitlmmdrlsnpaklrayalseqlkeimaplf
    qkhmddiisgefssgmmadwanddkklltwreetgktafetapqyegkigeqeyfdkgvl
    miamvkagvelafetmvdsgiieesayyeslhelpliantiarkrlyemnvvisdtaeyg
    nylfsyacvpllkpfmaelqpgdlgkaipegavdngqlrdvneairshaieqvgkklrgy
    mtdmkriavag
    

    Sequence, based on observed residues (ATOM records):
    >1yrlB (B:)
    nyfntlnlrqqlaqlgkcrfmgrdefadgasylqyeelipqadlvinltpdkqhsdvvrt
    vqplmkdgaalgyshgfnivevgeqirkditvvmvapkcpgtevreeykrgfgvptliav
    hpendpkgegmaiakawaaatgghragvlessfvaevksdlmgeqtilcgmlqagsllcf
    dklveegtdpayaekliqfgwetitealkqggitlmmdrlsnpaklrayalseqlkeima
    plfqkhmddiisgefssgmmadwanddkklltwreetgktafetapqyegkigeqeyfdk
    gvlmiamvkagvelafetmvdsgiieesayyeslhelpliantiarkrlyemnvvisdta
    eygnylfsyacvpllkpfmaelqpgdlgkaipegavdngqlrdvneairshaieqvgkkl
    rgymtdmkria
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yrlC (C:)
    manyfntlnlrqqlaqlgkcrfmgrdefadgasylqgkkvvivgcgaqglnqglnmrdsg
    ldisyalrkeaiaekraswrkatengfkvgtyeelipqadlvinltpdkqhsdvvrtvqp
    lmkdgaalgyshgfnivevgeqirkditvvmvapkcpgtevreeykrgfgvptliavhpe
    ndpkgegmaiakawaaatgghragvlessfvaevksdlmgeqtilcgmlqagsllcfdkl
    veegtdpayaekliqfgwetitealkqggitlmmdrlsnpaklrayalseqlkeimaplf
    qkhmddiisgefssgmmadwanddkklltwreetgktafetapqyegkigeqeyfdkgvl
    miamvkagvelafetmvdsgiieesayyeslhelpliantiarkrlyemnvvisdtaeyg
    nylfsyacvpllkpfmaelqpgdlgkaipegavdngqlrdvneairshaieqvgkklrgy
    mtdmkriavag
    

    Sequence, based on observed residues (ATOM records):
    >1yrlC (C:)
    nyfntlnlrqqlaqlgkcrfmgrdefadgasylqgkkvvivgcgaqglnqglnmrdsgld
    isyalrkeaiaekraswrkatengfkvgtyeelipqadlvinltpdkqhsdvvrtvqplm
    kdgaalgyshgfnivevgeqirkditvvmvapkcpgtevreeykrgfgvptliavhpend
    pkgegmaiakawaaatgghragvlessfvaevksdlmgeqtilcgmlqagsllcfdklve
    egtdpayaekliqfgwetitealkqggitlmmdrlsnpaklrayalseqlkeimaplfqk
    hmddiisgefssgmmadwanddkklltwreetgktafetapqyegkigeqeyfdkgvlmi
    amvkagvelafetmvdsgiieesayyeslhelpliantiarkrlyemnvvisdtaeygny
    lfsyacvpllkpfmaelqpgdlgkaipegavdngqlrdvneairshaieqvgkklrgymt
    dmkriav
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1yrlD (D:)
    manyfntlnlrqqlaqlgkcrfmgrdefadgasylqgkkvvivgcgaqglnqglnmrdsg
    ldisyalrkeaiaekraswrkatengfkvgtyeelipqadlvinltpdkqhsdvvrtvqp
    lmkdgaalgyshgfnivevgeqirkditvvmvapkcpgtevreeykrgfgvptliavhpe
    ndpkgegmaiakawaaatgghragvlessfvaevksdlmgeqtilcgmlqagsllcfdkl
    veegtdpayaekliqfgwetitealkqggitlmmdrlsnpaklrayalseqlkeimaplf
    qkhmddiisgefssgmmadwanddkklltwreetgktafetapqyegkigeqeyfdkgvl
    miamvkagvelafetmvdsgiieesayyeslhelpliantiarkrlyemnvvisdtaeyg
    nylfsyacvpllkpfmaelqpgdlgkaipegavdngqlrdvneairshaieqvgkklrgy
    mtdmkriavag
    

    Sequence, based on observed residues (ATOM records):
    >1yrlD (D:)
    nyfntlnlrqqlaqlgkcrfmgrdefadgasylqgkkvvivlnqglnmrdsgldisyalr
    keaiaegfkvgtyeelipqadlvinltpdkqhsdvvrtvqplmkdgaalgyshgfnivev
    geqirkditvvmvapkcpgtevreeykrgfgvptliavhpendpkgegmaiakawaaatg
    ghragvlessfvaevksdlmgeqtilcgmlqagsllcfdklveegtdpayaekliqfgwe
    titealkqggitlmmdrlsnpaklrayalseqlkeimaplfqkhmddiisgefssgmmad
    wanddkklltwreetgktafetapqyegkigeqeyfdkgvlmiamvkagvelafetmvds
    giieesayyeslhelpliantiarkrlyemnvvisdtaeygnylfsyacvpllkpfmael
    qpgdlgkaipegavdngqlrdvneairshaieqvgkklrgymtdmkriav