PDB entry 1yrk

View 1yrk on RCSB PDB site
Description: The C2 Domain of PKC is a new Phospho-Tyrosine Binding Domain
Class: protein binding
Keywords: C2 domain, PROTEIN BINDING
Deposited on 2005-02-03, released 2005-07-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C, delta type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05655 (3-125)
      • cloning artifact (0-2)
    Domains in SCOPe 2.03: d1yrka_
  • Chain 'B':
    Compound: 13-residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YRK (0-12)
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yrkA (A:)
gshmapflriafnsyelgslqaedeanqpfcavkmkealstergktlvqkkptmypewks
tfdahiyegrviqivlmraaeepvsevtvgvsvlaerckknngkaefwldlqpqakvlms
vqyfle

  • Chain 'B':
    No sequence available.