PDB entry 1yrh

View 1yrh on RCSB PDB site
Description: Crystal Structure Of Trp Repressor Binding Protein Wrba in complex with FMN
Class: protein binding
Keywords: alpha-beta twisted open sheet, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2005-02-03, released 2005-02-15
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1yrha1
  • Chain 'B':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1yrhb1
  • Chain 'C':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1yrhc1
  • Chain 'D':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1yrhd1
  • Chain 'E':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
    Domains in SCOP 1.75: d1yrhe1
  • Chain 'F':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (3-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1yrhf1
  • Chain 'G':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1yrhg1
  • Chain 'H':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1yrhh1
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrhA (A:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhA (A:)
    pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
    kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
    nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
    irhqvrrqveltaklleggs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrhB (B:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhB (B:)
    pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
    kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
    nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
    irhqvrrqveltaklleggs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yrhC (C:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhC (C:)
    apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
    mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
    qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
    sirhqvrrqveltaklleggs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yrhD (D:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhD (D:)
    apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
    mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
    qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
    sirhqvrrqveltaklleggs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yrhE (E:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhE (E:)
    pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
    kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
    nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
    irhqvrrqveltaklleg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yrhF (F:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhF (F:)
    tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
    amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
    aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
    asirhqvrrqveltaklleggs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yrhG (G:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhG (G:)
    pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
    kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
    nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
    irhqvrrqveltaklleggs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yrhH (H:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhH (H:)
    apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
    mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
    qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
    sirhqvrrqveltaklleggs