PDB entry 1yrg

View 1yrg on RCSB PDB site
Description: the crystal structure of rna1p: a new fold for a gtpase-activating protein
Deposited on 1999-03-29, released 2000-03-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1yrga_
  • Chain 'B':
    Domains in SCOP 1.55: d1yrgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yrgA (A:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yrgB (B:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme