PDB entry 1yre

View 1yre on RCSB PDB site
Description: Hypothetical protein PA3270 from Pseudomonas aeruginosa in complex with CoA
Class: structural genomics, unknown function
Keywords: APC5563, PA3270, Midwest Center for Structural Genomics, MSCG, Protein Structure Initiative, PSI, MCSG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-02-03, released 2005-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA3270
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • GB AAG06658
    Domains in SCOPe 2.06: d1yrea1
  • Chain 'B':
    Compound: hypothetical protein PA3270
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • GB AAG06658
    Domains in SCOPe 2.06: d1yreb_
  • Chain 'C':
    Compound: hypothetical protein PA3270
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • GB AAG06658
    Domains in SCOPe 2.06: d1yrec_
  • Chain 'D':
    Compound: hypothetical protein PA3270
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • GB AAG06658
    Domains in SCOPe 2.06: d1yred_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yreA (A:)
    ghmsrrapmfkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrq
    slaeqregralplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikyl
    mlkhafdnlrmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysit
    dhewpqvkaaleasftg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yreA (A:)
    lpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregralp
    lavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmv
    rvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaale
    asf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yreB (B:)
    ghmsrrapmfkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrq
    slaeqregralplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikyl
    mlkhafdnlrmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysit
    dhewpqvkaaleasftg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yreB (B:)
    fkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregr
    alplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnl
    rmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvka
    aleasft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yreC (C:)
    ghmsrrapmfkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrq
    slaeqregralplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikyl
    mlkhafdnlrmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysit
    dhewpqvkaaleasftg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yreC (C:)
    pitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregralpl
    avrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmvr
    vqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaalea
    sf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yreD (D:)
    ghmsrrapmfkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrq
    slaeqregralplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikyl
    mlkhafdnlrmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysit
    dhewpqvkaaleasftg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yreD (D:)
    fkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregr
    alplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnl
    rmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvka
    aleasft