PDB entry 1yrb

View 1yrb on RCSB PDB site
Description: PAB0955 crystal structure : a GTPase in GDP and Mg bound form from Pyrococcus abyssi
Class: hydrolase
Keywords: GTP binding protein, GTPase, P-loop, Rossmann Fold, GDP, HYDROLASE
Deposited on 2005-02-03, released 2006-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP(GTP)binding protein
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: pab0955
    Database cross-references and differences (RAF-indexed):
    • GB CAB50343 (14-End)
      • expression tag (0-13)
    Domains in SCOPe 2.08: d1yrba2, d1yrba3
  • Chain 'B':
    Compound: ATP(GTP)binding protein
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: pab0955
    Database cross-references and differences (RAF-indexed):
    • GB CAB50343 (14-End)
      • expression tag (0-13)
    Domains in SCOPe 2.08: d1yrbb2, d1yrbb3
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrbA (A:)
    mrgshhhhhhgmasmivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyep
    sidvrefvtveeimregygpngaivesydrlmekfneylnkilrlekendyvlidtpgqm
    etflfhefgvrlmenlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnk
    vdllseeekerhrkyfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsakt
    regfedletlayehyctcgdlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrbA (A:)
    mrgshhhhhhgmasmivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyep
    sidvrefvtveeimregygpngaivesydrlmekfneylnkilrlekendyvlidtpgqm
    etflfhefgvrlmenlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnk
    vdllseeekerhrkyfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsakt
    regfedletlayehyctcg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrbB (B:)
    mrgshhhhhhgmasmivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyep
    sidvrefvtveeimregygpngaivesydrlmekfneylnkilrlekendyvlidtpgqm
    etflfhefgvrlmenlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnk
    vdllseeekerhrkyfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsakt
    regfedletlayehyctcgdlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrbB (B:)
    mrgshhhhhhgmasmivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyep
    sidvrefvtveeimregygpngaivesydrlmekfneylnkilrlekendyvlidtpgqm
    etflfhefgvrlmenlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnk
    vdllseeekerhrkyfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsakt
    regfedletlayehyctcgd