PDB entry 1yr6

View 1yr6 on RCSB PDB site
Description: PAB0955 crystal structure : a GTPase in Apo form from Pyrococcus abyssi
Class: hydrolase
Keywords: GTP binding protein, GTPase, P-loop, Rossmann Fold, HYDROLASE
Deposited on 2005-02-03, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP(GTP)binding protein
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: pab0955
    Database cross-references and differences (RAF-indexed):
    • GB CAB50343 (14-End)
      • expression tag (10-13)
    Domains in SCOPe 2.07: d1yr6a1, d1yr6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yr6A (A:)
    mrgshhhhhhgmasmivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyep
    sidvrefvtveeimregygpngaivesydrlmekfneylnkilrlekendyvlidtpgqm
    etflfhefgvrlmenlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnk
    vdllseeekerhrkyfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsakt
    regfedletlayehyctcgdlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yr6A (A:)
    gmasmivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtv
    eeimregygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgv
    rlmenlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeeke
    rhrkyfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletl
    ayehyctc