PDB entry 1yr4

View 1yr4 on RCSB PDB site
Description: 1.2A resolution structure of a crayfish trypsin complexed with a peptide inhibitor, SGTI
Deposited on 2005-02-03, released 2005-06-14
The last revision was dated 2006-04-18, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.139
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Pontastacus leptodactylus
  • Chain 'B':
    Compound: Serine protease inhibitor I/II
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yr4A (A:)
    ivggtdatlgefpyqlsfqetfigfsfhfcgasiynenyaitaghcvygddyenpsglqi
    vageldmsvnegseqiitvskiilhenfdynlldndisllklsgsltfndnvapialpeq
    ghtatgdvivtgwgttseggntpdvlqkvtvplvsdedcradygadeildsmicagvpeg
    gkdscqgdsggplaasdtgstylagivswgygcarpgypgvytevsyhvdwikanav
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yr4B (B:)
    eqectpgqtkkqdcntcnctptgvwactrkgcpph
    

    Sequence, based on observed residues (ATOM records):
    >1yr4B (B:)
    qectpgqtkkqdcntcnctptgvwactrkgcpp