PDB entry 1yr1

View 1yr1 on RCSB PDB site
Description: Structure of the major extracytoplasmic domain of the trans isomer of the bacterial cell division protein divib from geobacillus stearothermophilus
Deposited on 2005-02-02, released 2006-02-07
The last revision was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell-division initiation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: DivIB
    Database cross-references and differences (RAF-indexed):
    • PDB 1YR1 (0-118)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yr1A (A:)
    gsewrriayvydrqtffpllengrllkqegtktapsdapvlvgwkdgdaiaemtgqlael
    paavlgamseihykptreyedrvivymndgyevsatirqfadklshypaiaaaldrnvk