PDB entry 1yqz

View 1yqz on RCSB PDB site
Description: Structure of Coenzyme A-Disulfide Reductase from Staphylococcus aureus refined at 1.54 Angstrom resolution
Deposited on 2005-02-02, released 2006-05-09
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.177
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coenzyme A disulfide reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52582 (Start-437)
      • see remark 999 (167)
  • Chain 'B':
    Compound: coenzyme A disulfide reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52582 (Start-437)
      • see remark 999 (167)
  • Heterogens: MG, CL, COA, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yqzA (A:)
    mpkivvvgavaggatcasqirrldkesdiiifekdrdmsfancalpyvigevvedrryal
    aytpekfydrkqitvktyheviainderqtvsvlnrktneqfeesydklilspgasansl
    gfesditftlrnledtdaidqfikanqvdkvlvvgagyvslevlenlyerglhptlihrs
    dkinklmdadmnqpildeldkreipyrlneeinaingneitfksgkvehydmiiegvgth
    pnskfiessnikldrkgfipvndkfetnvpniyaigdiatshyrhvdlpasvplawgahr
    aasivaeqiagndtiefkgflgnnivkffdytfasvgvkpnelkqfdykmvevtqgahan
    yypgnsplhlrvyydtsnrqilraaavgkegadkridvlsmammnqltvdeltefevaya
    ppyshpkdlinmigykak
    

    Sequence, based on observed residues (ATOM records):
    >1yqzA (A:)
    pkivvvgavaggatcasqirrldkesdiiifekdrdmsfancalpyvigevvedrryala
    ytpekfydrkqitvktyheviainderqtvsvlnrktneqfeesydklilspgasanslg
    fesditftlrnledtdaidqfikanqvdkvlvvgagyvslevlenlyerglhptlihrsd
    kinklmdadmnqpildeldkreipyrlneeinaingneitfksgkvehydmiiegvgthp
    nskfiessnikldrkgfipvndkfetnvpniyaigdiatshyrhvdlpasvplawgahra
    asivaeqiagndtiefkgflgnnivkffdytfasvgvkpnelkqfdykmvevtqgahany
    ypgnsplhlrvyydtsnrqilraaavgkegadkridvlsmammnqltvdeltefevayap
    pyshpkdlinmigykak
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yqzB (B:)
    mpkivvvgavaggatcasqirrldkesdiiifekdrdmsfancalpyvigevvedrryal
    aytpekfydrkqitvktyheviainderqtvsvlnrktneqfeesydklilspgasansl
    gfesditftlrnledtdaidqfikanqvdkvlvvgagyvslevlenlyerglhptlihrs
    dkinklmdadmnqpildeldkreipyrlneeinaingneitfksgkvehydmiiegvgth
    pnskfiessnikldrkgfipvndkfetnvpniyaigdiatshyrhvdlpasvplawgahr
    aasivaeqiagndtiefkgflgnnivkffdytfasvgvkpnelkqfdykmvevtqgahan
    yypgnsplhlrvyydtsnrqilraaavgkegadkridvlsmammnqltvdeltefevaya
    ppyshpkdlinmigykak
    

    Sequence, based on observed residues (ATOM records):
    >1yqzB (B:)
    pkivvvgavaggatcasqirrldkesdiiifekdrdmsfancalpyvigevvedrryala
    ytpekfydrkqitvktyheviainderqtvsvlnrktneqfeesydklilspgasanslg
    fesditftlrnledtdaidqfikanqvdkvlvvgagyvslevlenlyerglhptlihrsd
    kinklmdadmnqpildeldkreipyrlneeinaingneitfksgkvehydmiiegvgthp
    nskfiessnikldrkgfipvndkfetnvpniyaigdiatshyrhvdlpasvplawgahra
    asivaeqiagndtiefkgflgnnivkffdytfasvgvkpnelkqfdykmvevtqgahany
    ypgnsplhlrvyydtsnrqilraaavgkegadkridvlsmammnqltvdeltefevayap
    pyshpkdlinmigykak