PDB entry 1yqy

View 1yqy on RCSB PDB site
Description: Structure of B. Anthrax Lethal factor in complex with a hydroxamate inhibitor
Class: hydrolase
Keywords: Toxin, Lethal Factor, inhibitors, hydroxamate, HYDROLASE
Deposited on 2005-02-02, released 2005-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lethal Factor
    Species: Bacillus anthracis [TaxId:1392]
    Gene: lef
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15917 (Start-518)
      • variant (8)
      • cloning artifact (519-520)
    Domains in SCOPe 2.08: d1yqya1, d1yqya2, d1yqya3
  • Heterogens: ZN, 915, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqyA (A:)
    gskdpgmlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeeke
    llkriqidssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflk
    klkldiqpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiyl
    yenmninnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldne
    rlkwriqlspdtragylengklilqrnigleikdvqiikqsekeyiridakvvpkskidt
    kiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknniqsdlikk
    vtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhgpskgvel
    rndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygrtneaeff
    aeafrlmhstdhaerlkvqknapktfqfindqikfiinslvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqyA (A:)
    lsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqi
    dssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiq
    pydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmnin
    nltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriq
    lspdtragylengklilqrnigleikdvqiikqsekeyiridakvvpkskidtkiqeaql
    ninqewnkalglpkytklitfnvhnryasnivesaylilnewknniqsdlikkvtnylvd
    gngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhgpskgvelrndsegf
    ihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygrtneaeffaeafrlm
    hstdhaerlkvqknapktfqfindqikfiinslv