PDB entry 1yqx

View 1yqx on RCSB PDB site
Description: Sinapyl Alcohol Dehydrogenase at 2.5 Angstrom Resolution
Deposited on 2005-02-02, released 2005-07-12
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sinapyl alcohol dehydrogenase
    Species: Populus tremuloides [TaxId:3693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94G59 (Start-365)
      • engineered (143)
  • Chain 'B':
    Compound: sinapyl alcohol dehydrogenase
    Species: Populus tremuloides [TaxId:3693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94G59 (Start-365)
      • engineered (143)
  • Heterogens: ZN, NAP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yqxA (A:)
    gshgmskspeeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhs
    ikndwgfsmyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandleny
    cpkmiltyasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplk
    yfgldepgkhigivglgglghvavkfakafgskvtvistspskkeealknfgadsflvsr
    dqeqmqaaagtldgiidtvsavhpllplfgllkshgklilvgapekplelpafsliagrk
    ivagsgiggmketqemidfaakhnitadievistdylntamerlakndvryrfvidvgnt
    laatkp
    

    Sequence, based on observed residues (ATOM records):
    >1yqxA (A:)
    speeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhsikndwgf
    smyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandlenycpkmilt
    yasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplkyfgldep
    gkhigivglgglghvavkfakafgskvtvistspskkeealknfgadsflvsrdqeqmqa
    aagtldgiidtvsavhpllplfgllkshgklilvgapekplelpafsliagrkivagsgi
    ggmketqemidfaakhnitadievistdylntamerlakndvryrfvidvgntlaatkp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yqxB (B:)
    gshgmskspeeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhs
    ikndwgfsmyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandleny
    cpkmiltyasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplk
    yfgldepgkhigivglgglghvavkfakafgskvtvistspskkeealknfgadsflvsr
    dqeqmqaaagtldgiidtvsavhpllplfgllkshgklilvgapekplelpafsliagrk
    ivagsgiggmketqemidfaakhnitadievistdylntamerlakndvryrfvidvgnt
    laatkp
    

    Sequence, based on observed residues (ATOM records):
    >1yqxB (B:)
    speeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhsikndwgf
    smyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandlenycpkmilt
    yasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplkyfgldep
    gkhigivglgglghvavkfakafgskvtvistspskkeealknfgadsflvsrdqeqmqa
    aagtldgiidtvsavhpllplfgllkshgklilvgapekplelpafsliagrkivagsgi
    ggmketqemidfaakhnitadievistdylntamerlakndvryrfvidvgntlaatkp