PDB entry 1yqt

View 1yqt on RCSB PDB site
Description: rnase-l inhibitor
Deposited on 2005-02-02, released 2005-04-19
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNase l inhibitor
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U306 (Start-537)
      • modified residue (47)
      • see remark 999 (152)
      • modified residue (330)
      • modified residue (447)
      • modified residue (463)
      • modified residue (472)
      • modified residue (488)
      • modified residue (490)
      • modified residue (494)
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yqtA (A:)
    mgsshhhhhhssglvprshmeqleedcvhrygvnafvlyrlpvvkegmvvgivgpngtgk
    stavkilagqlipnlcgdndswdgvirafrgnelqnyfeklkngeirpvvkpqyvdlipk
    avkgkviellkkadetgkleevvkalelenvlereiqhlsggelqrvaiaaallrnatfy
    ffdepssyldirqrlnaarairrlseegksvlvvehdlavldylsdiihvvygepgvygi
    fsqpkgtrngineflrgylkdenvrfrpyeikftktgerveieretlvtyprlvkdygsf
    rlevepgeikkgevigivgpngigkttfvkmlagveeptegkiewdltvaykpqyikady
    egtvyellskidasklnsnfyktellkplgiidlydrevnelsggelqrvaiaatllrda
    diylldepsayldveqrlavsrairhlmeknektalvvehdvlmidyvsdrlmvfegepg
    kygralppmgmregmnrflasigitfrrdpdtgrprankegsvkdreqkekgeyyyia
    

    Sequence, based on observed residues (ATOM records):
    >1yqtA (A:)
    eedcvhrygvnafvlyrlpvvkegmvvgivgpngtgkstavkilagqlipnlcgdndswd
    gvirafrgnelqnyfeklkngeirpvvkpqyvdlipkavkgkviellkkadetgkleevv
    kalelenvlereiqhlsggelqrvaiaaallrnatfyffdepssyldirqrlnaarairr
    lseegksvlvvehdlavldylsdiihvvygepgvygifsqpkgtrngineflrgylkden
    vrfrpyeikftktgerveieretlvtyprlvkdygsfrlevepgeikkgevigivgpngi
    gkttfvkmlagveeptegkiewdltvaykpqyikadyegtvyellskidasklnsnfykt
    ellkplgiidlydrevnelsggelqrvaiaatllrdadiylldepsayldveqrlavsra
    irhlmeknektalvvehdvlmidyvsdrlmvfegepgkygralppmgmregmnrflasig
    itfrrdpdtgrprankegsvkdreqkekgeyyyia