PDB entry 1yqs

View 1yqs on RCSB PDB site
Description: Inhibition of the R61 DD-Peptidase by N-benzoyl-beta-sultam
Class: hydrolase
Keywords: cell well biosynthesis, beta-lactam, beta-sultam, peptidase, sulfonylation, HYDROLASE
Deposited on 2005-02-02, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.114
AEROSPACI score: 1.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptomyces sp. [TaxId:31952]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yqsa_
  • Heterogens: BSA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqsA (A:)
    adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
    gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
    aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
    teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
    isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
    tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqsA (A:)
    lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
    vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
    tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
    yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
    stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
    qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp