PDB entry 1yqr

View 1yqr on RCSB PDB site
Description: Catalytically inactive human 8-oxoguanine glycosylase crosslinked to oxoG containing DNA
Class: hydrolase/DNA
Keywords: Disulfide crosslinking, crosslinking validation, HYDROLASE-DNA COMPLEX
Deposited on 2005-02-02, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1, MMH, MUTM, OGH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (3-End)
      • cloning artifact (0-2)
      • engineered (140)
      • engineered (240)
    Domains in SCOPe 2.07: d1yqra1, d1yqra2, d1yqra3
  • Chain 'B':
    Compound: 5'-d(p*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*g)-3'
  • Chain 'C':
    Compound: 5'-d(p*cp*gp*tp*cp*cp*ap*(8og)p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqrA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
    gvrllrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqala
    gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
    qvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
    pyagwaqavlfsadlrqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqrA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqva
    dciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.