PDB entry 1yqo

View 1yqo on RCSB PDB site
Description: T268A mutant heme domain of flavocytochrome P450 BM3
Class: oxidoreductase
Keywords: cytochrome P450, fatty acid hydroxylase, OXIDOREDUCTASE
Deposited on 2005-02-02, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779 (Start-454)
      • engineered (267)
    Domains in SCOPe 2.07: d1yqoa_
  • Chain 'B':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779 (Start-454)
      • engineered (267)
    Domains in SCOPe 2.07: d1yqob_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqoA (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliagheatsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqoA (A:)
    kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
    desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
    avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
    eamnklnkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeni
    ryqiitfliagheatsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyv
    gmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveef
    rperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldik
    etltlkpegfvvkakskkipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yqoB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliagheatsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqoB (B:)
    kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
    desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
    avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
    eamnklnkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeni
    ryqiitfliagheatsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyv
    gmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveef
    rperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldik
    etltlkpegfvvkakskkipl