PDB entry 1yqn

View 1yqn on RCSB PDB site
Description: E. coli ispF double mutant
Class: lyase
Keywords: 2C-methyl-D-erythriol-2, 4-cyclodiphosphate synthase R142M/E144K (ispF mutant), alpha-beta protein, LYASE
Deposited on 2005-02-02, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: 0.189
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: ISPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62617 (2-End)
      • cloning artifact (0-1)
      • engineered (143)
      • engineered (145)
    Domains in SCOPe 2.07: d1yqna1, d1yqna2
  • Heterogens: ZN, MN, CDP, GPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqnA (A:)
    aemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgmglgiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqnA (A:)
    aemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgmglgiaceavallik