PDB entry 1yqm

View 1yqm on RCSB PDB site
Description: Catalytically inactive human 8-oxoguanine glycosylase crosslinked to 7-deazaguanine containing DNA
Class: hydrolase/DNA
Keywords: Disulfide crosslinking, 8-oxoG analog, HYDROLASE/DNA COMPLEX
Deposited on 2005-02-02, released 2005-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1, MMH, MUTM, OGH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (3-End)
      • cloning artifact (0-2)
      • engineered (140)
      • engineered (240)
    Domains in SCOPe 2.06: d1yqma1, d1yqma2, d1yqma3
  • Chain 'B':
    Compound: 5'-d(p*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(p*gp*tp*cp*cp*ap*(7gu)p*gp*tp*cp*tp*ap*c)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqmA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
    gvrllrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqala
    gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
    qvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
    pyagwaqavlfsadlrqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqmA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqva
    dciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.