PDB entry 1yqj

View 1yqj on RCSB PDB site
Description: Crystal Structure of p38 Alpha in Complex with a Selective Pyridazine Inhibitor
Class: transferase
Keywords: transferase
Deposited on 2005-02-01, released 2005-04-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: HOMO SAPIENS
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (7-End)
      • cloning artifact (2-6)
    Domains in SCOP 1.73: d1yqja1
  • Heterogens: SO4, 6NP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqjA (A:)
    gshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqjA (A:)
    hmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkls
    rpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnni
    vkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtd
    demtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklil
    rlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkr
    itaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp