PDB entry 1yqi

View 1yqi on RCSB PDB site
Description: VCP/p97 complexed with ADP
Deposited on 2005-02-01, released 2005-03-22
The last revision was dated 2008-04-22, with a file datestamp of 2008-04-18.
Experiment type: XRAY
Resolution: 4.25 Å
R-factor: 0.276
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: MUS MUSCULUS
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01853
      • modified residue (45)
      • modified residue (83)
      • modified residue (157)
      • modified residue (218)
      • modified residue (274)
      • modified residue (331)
      • modified residue (343)
      • modified residue (387)
      • modified residue (426)
      • modified residue (441)
      • modified residue (448)
      • modified residue (507)
      • modified residue (549)
      • modified residue (607)
      • modified residue (610)
      • modified residue (677)
      • modified residue (739)
      • modified residue (756)
  • Chain 'B':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: MUS MUSCULUS
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01853
      • modified residue (45)
      • modified residue (83)
      • modified residue (157)
      • modified residue (218)
      • modified residue (274)
      • modified residue (331)
      • modified residue (343)
      • modified residue (387)
      • modified residue (426)
      • modified residue (441)
      • modified residue (448)
      • modified residue (507)
      • modified residue (549)
      • modified residue (607)
      • modified residue (610)
      • modified residue (677)
      • modified residue (739)
      • modified residue (756)
  • Chain 'C':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: MUS MUSCULUS
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01853
      • modified residue (45)
      • modified residue (83)
      • modified residue (157)
      • modified residue (218)
      • modified residue (274)
      • modified residue (331)
      • modified residue (343)
      • modified residue (387)
      • modified residue (426)
      • modified residue (441)
      • modified residue (448)
      • modified residue (507)
      • modified residue (549)
      • modified residue (607)
      • modified residue (610)
      • modified residue (677)
      • modified residue (739)
      • modified residue (756)
  • Heterogens: ZN, ADP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yqiA (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records):
    >1yqiA (A:)
    ivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdekirmnr
    vvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfleayrpi
    rkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslnevgyddv
    ggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravanetgaff
    flingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgeverrivs
    qlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrleilqihtk
    nmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidaevmnsla
    vtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehpdkflkf
    gmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvreifdka
    rqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfiigatnrp
    diidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtngfsgad
    lteicqracklairesirrdhfeeamrfarrsvsdndirkyemfa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yqiB (B:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records):
    >1yqiB (B:)
    ivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdekirmnr
    vvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfleayrpi
    rkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslnevgyddv
    ggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravanetgaff
    flingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgeverrivs
    qlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrleilqihtk
    nmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidaevmnsla
    vtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehpdkflkf
    gmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvreifdka
    rqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfiigatnrp
    diidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtngfsgad
    lteicqracklairesiesrrdhfeeamrfarrsvsdndirkyemfa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yqiC (C:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records):
    >1yqiC (C:)
    ivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdekirmnr
    vvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfleayrpi
    rkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslnevgyddv
    ggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravanetgaff
    flingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgeverrivs
    qlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrleilqihtk
    nmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidaevmnsla
    vtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehpdkflkf
    gmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvreifdka
    rqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfiigatnrp
    diidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtngfsgad
    lteicqracklairesvpeirrdhfeeamrfarrsvsdndirkyemfa