PDB entry 1yqh

View 1yqh on RCSB PDB site
Description: Stucture of domain of unknown function DUF77 from Bacillus cereus
Class: structural genomics, unknown function
Keywords: Bacillus cereus, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-02-01, released 2005-03-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IG hypothetical 16092
    Species: Bacillus cereus
    Gene: IG hypothetical 16092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81IG4 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (9)
      • modified residue (45)
    Domains in SCOP 1.73: d1yqha1
  • Chain 'B':
    Compound: IG hypothetical 16092
    Species: Bacillus cereus
    Gene: IG hypothetical 16092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81IG4 (3-End)
      • modified residue (3)
      • modified residue (9)
      • modified residue (45)
    Domains in SCOP 1.73: d1yqhb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqhA (A:)
    snamsqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldv
    vkraqqacvdagaeevitsikihyrpstgvtidekvwkyrdeyakpeai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqhA (A:)
    snamsqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldv
    vkraqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yqhB (B:)
    snamsqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldv
    vkraqqacvdagaeevitsikihyrpstgvtidekvwkyrdeyakpeai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqhB (B:)
    msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkr
    aqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya