PDB entry 1yqh

View 1yqh on RCSB PDB site
Description: Structure of domain of unknown function DUF77 from Bacillus cereus
Class: structural genomics, unknown function
Keywords: Bacillus cereus, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-02-01, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IG hypothetical 16092
    Species: Bacillus cereus [TaxId:226900]
    Gene: IG hypothetical 16092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81IG4 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (9)
      • modified residue (45)
    Domains in SCOPe 2.07: d1yqha1, d1yqha2
  • Chain 'B':
    Compound: IG hypothetical 16092
    Species: Bacillus cereus [TaxId:226900]
    Gene: IG hypothetical 16092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81IG4 (3-End)
      • modified residue (3)
      • modified residue (9)
      • modified residue (45)
    Domains in SCOPe 2.07: d1yqhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqhA (A:)
    snamsqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldv
    vkraqqacvdagaeevitsikihyrpstgvtidekvwkyrdeyakpeai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqhA (A:)
    snamsqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldv
    vkraqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yqhB (B:)
    snamsqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldv
    vkraqqacvdagaeevitsikihyrpstgvtidekvwkyrdeyakpeai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqhB (B:)
    msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkr
    aqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya