PDB entry 1yqf

View 1yqf on RCSB PDB site
Description: Hypothetical protein from leishmania major unknown function sequence homologue to human p32 protein
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP
Deposited on 2005-02-01, released 2005-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.255
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Lmaj011689
    Species: Leishmania major
    Domains in SCOP 1.73: d1yqfa1
  • Chain 'B':
    Compound: hypothetical protein Lmaj011689
    Species: Leishmania major
    Domains in SCOP 1.73: d1yqfb1
  • Chain 'C':
    Compound: hypothetical protein Lmaj011689
    Species: Leishmania major
    Domains in SCOP 1.73: d1yqfc1
  • Chain 'D':
    Compound: hypothetical protein Lmaj011689
    Species: Leishmania major
    Domains in SCOP 1.73: d1yqfd1
  • Chain 'E':
    Compound: hypothetical protein Lmaj011689
    Species: Leishmania major
    Domains in SCOP 1.73: d1yqfe1
  • Chain 'F':
    Compound: hypothetical protein Lmaj011689
    Species: Leishmania major
    Domains in SCOP 1.73: d1yqff1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqfA (A:)
    mahhhhhhmsaptaltvprrsasdaaladatrreleeemgrsdkpeqptppagwqvvrkp
    gtctfdltksfegedlvvrystnqdsdkanshnifvyitqkngqtmqadlsieegelvln
    nirfydeaalakdtgaeaeakrnelytgplvheldydllncvmtylekrgvdeklgefvv
    lysfwaeqqdyeawlttmnkfas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqfA (A:)
    asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
    tnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeak
    rnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkf
    as
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yqfB (B:)
    mahhhhhhmsaptaltvprrsasdaaladatrreleeemgrsdkpeqptppagwqvvrkp
    gtctfdltksfegedlvvrystnqdsdkanshnifvyitqkngqtmqadlsieegelvln
    nirfydeaalakdtgaeaeakrnelytgplvheldydllncvmtylekrgvdeklgefvv
    lysfwaeqqdyeawlttmnkfas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqfB (B:)
    asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
    tnqdshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeakrnely
    tgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkfas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yqfC (C:)
    mahhhhhhmsaptaltvprrsasdaaladatrreleeemgrsdkpeqptppagwqvvrkp
    gtctfdltksfegedlvvrystnqdsdkanshnifvyitqkngqtmqadlsieegelvln
    nirfydeaalakdtgaeaeakrnelytgplvheldydllncvmtylekrgvdeklgefvv
    lysfwaeqqdyeawlttmnkfas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqfC (C:)
    sdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvryst
    nqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeakr
    nelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkfa
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yqfD (D:)
    mahhhhhhmsaptaltvprrsasdaaladatrreleeemgrsdkpeqptppagwqvvrkp
    gtctfdltksfegedlvvrystnqdsdkanshnifvyitqkngqtmqadlsieegelvln
    nirfydeaalakdtgaeaeakrnelytgplvheldydllncvmtylekrgvdeklgefvv
    lysfwaeqqdyeawlttmnkfas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqfD (D:)
    asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
    tnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeak
    rnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkf
    as
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yqfE (E:)
    mahhhhhhmsaptaltvprrsasdaaladatrreleeemgrsdkpeqptppagwqvvrkp
    gtctfdltksfegedlvvrystnqdsdkanshnifvyitqkngqtmqadlsieegelvln
    nirfydeaalakdtgaeaeakrnelytgplvheldydllncvmtylekrgvdeklgefvv
    lysfwaeqqdyeawlttmnkfas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqfE (E:)
    asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
    tnqdsnshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeakrne
    lytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkfas
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yqfF (F:)
    mahhhhhhmsaptaltvprrsasdaaladatrreleeemgrsdkpeqptppagwqvvrkp
    gtctfdltksfegedlvvrystnqdsdkanshnifvyitqkngqtmqadlsieegelvln
    nirfydeaalakdtgaeaeakrnelytgplvheldydllncvmtylekrgvdeklgefvv
    lysfwaeqqdyeawlttmnkfas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqfF (F:)
    asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
    tnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeak
    rnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkf
    as