PDB entry 1yqe

View 1yqe on RCSB PDB site
Description: Crystal Structure of Conserved Protein of Unknown Function AF0625
Class: structural genomics, unknown function
Keywords: AF0625,Sulfur SAD, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-02-01, released 2005-03-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.206
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0204 protein AF0625
    Species: Archaeoglobus fulgidus
    Gene: gi|2649994
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29630 (4-281)
      • cloning artifact (0-3)
    Domains in SCOP 1.73: d1yqea1
  • Heterogens: POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yqeA (A:)
fqghmklvvcsesdtagqnikdnlltfadfeekdvgefklylsdefyiaetkerliyadh
ideklakyidfeeilfasrhsskdgrkiftvhvsgnvgtadfggkpyslakpspqtmkny
vlalrerldrkpefeftmevthhgpseiskpsafyeigsteeewkdreaaevvaeamlda
iraekmdwnvavgvggthyaprqteimltttftfghnfakytfehltaeflvkavklsea
eyiiideksvnsavkkivneaaevagvevlkskkvkkdfrlv