PDB entry 1yqe

View 1yqe on RCSB PDB site
Description: Crystal Structure of Conserved Protein of Unknown Function AF0625
Class: structural genomics, unknown function
Keywords: AF0625,Sulfur SAD, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-02-01, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.206
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical UPF0204 protein AF0625
  Species: Archaeoglobus fulgidus [TaxId:2234]
  Gene: gi|2649994
  Database cross-references and differences (RAF-indexed):
  • Uniprot O29630 (4-281)
    • cloning artifact (0-3)
  Domains in SCOPe 2.08: d1yqea1, d1yqea2
• Heterogens: POP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yqeA (A:)
  fqghmklvvcsesdtagqnikdnlltfadfeekdvgefklylsdefyiaetkerliyadh
  ideklakyidfeeilfasrhsskdgrkiftvhvsgnvgtadfggkpyslakpspqtmkny
  vlalrerldrkpefeftmevthhgpseiskpsafyeigsteeewkdreaaevvaeamlda
  iraekmdwnvavgvggthyaprqteimltttftfghnfakytfehltaeflvkavklsea
  eyiiideksvnsavkkivneaaevagvevlkskkvkkdfrlv