PDB entry 1yqd

View 1yqd on RCSB PDB site
Description: Sinapyl Alcohol Dehydrogenase complexed with NADP+
Deposited on 2005-02-01, released 2005-07-12
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.195
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sinapyl alcohol dehydrogenase
    Species: Populus tremuloides [TaxId:3693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94G59 (Start-365)
      • engineered (143)
  • Chain 'B':
    Compound: sinapyl alcohol dehydrogenase
    Species: Populus tremuloides [TaxId:3693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94G59 (Start-365)
      • engineered (143)
  • Heterogens: ZN, NAP, DTT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yqdA (A:)
    gshgmskspeeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhs
    ikndwgfsmyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandleny
    cpkmiltyasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplk
    yfgldepgkhigivglgglghvavkfakafgskvtvistspskkeealknfgadsflvsr
    dqeqmqaaagtldgiidtvsavhpllplfgllkshgklilvgapekplelpafsliagrk
    ivagsgiggmketqemidfaakhnitadievistdylntamerlakndvryrfvidvgnt
    laatkp
    

    Sequence, based on observed residues (ATOM records):
    >1yqdA (A:)
    speeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhsikndwgf
    smyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandlenycpkmilt
    yasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplkyfgldep
    gkhigivglgglghvavkfakafgskvtvistspskkeealknfgadsflvsrdqeqmqa
    aagtldgiidtvsavhpllplfgllkshgklilvgapekplelpafsliagrkivagsgi
    ggmketqemidfaakhnitadievistdylntamerlakndvryrfvidvgntlaatkp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yqdB (B:)
    gshgmskspeeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhs
    ikndwgfsmyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandleny
    cpkmiltyasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplk
    yfgldepgkhigivglgglghvavkfakafgskvtvistspskkeealknfgadsflvsr
    dqeqmqaaagtldgiidtvsavhpllplfgllkshgklilvgapekplelpafsliagrk
    ivagsgiggmketqemidfaakhnitadievistdylntamerlakndvryrfvidvgnt
    laatkp
    

    Sequence, based on observed residues (ATOM records):
    >1yqdB (B:)
    speeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhsikndwgf
    smyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandlenycpkmilt
    yasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplkyfgldep
    gkhigivglgglghvavkfakafgskvtvistspskkeealknfgadsflvsrdqeqmqa
    aagtldgiidtvsavhpllplfgllkshgklilvgapekplelpafsliagrkivagsgi
    ggmketqemidfaakhnitadievistdylntamerlakndvryrfvidvgntlaatkp