PDB entry 1yqc

View 1yqc on RCSB PDB site
Description: Crystal Structure of Ureidoglycolate Hydrolase (AllA) from Escherichia coli O157:H7
Class: hydrolase
Keywords: AllA, Ureidoglycolate, Hydrolase, Purine metabolism, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI
Deposited on 2005-02-01, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycolate hydrolase
    Species: Escherichia coli [TaxId:83334]
    Gene: allA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63486 (0-159)
      • modified residue (0)
      • modified residue (83)
    Domains in SCOPe 2.07: d1yqca1
  • Chain 'B':
    Compound: Ureidoglycolate hydrolase
    Species: Escherichia coli [TaxId:83334]
    Gene: allA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63486 (0-159)
      • modified residue (0)
      • modified residue (83)
    Domains in SCOPe 2.07: d1yqcb_
  • Heterogens: GLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqcA (A:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfagshhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqcA (A:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yqcB (B:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfagshhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqcB (B:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa