PDB entry 1yqb

View 1yqb on RCSB PDB site
Description: Human Ubiquilin 3
Class: signaling protein
Keywords: Structural Genomics Consortium, Ubiquitin, Ubiquitin-like domain, Ubiquilin 3, Structural Genomics, SIGNALING PROTEIN, SGC
Deposited on 2005-02-01, released 2005-02-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquilin 3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBQLN3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H347 (19-End)
      • expression tag (11-18)
    Domains in SCOPe 2.02: d1yqba1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yqbA (A:)
mgsshhhhhhssglvprgsphlikvtvktpkdkedfsvtdtctiqqlkeeisqrfkahpd
qlvlifagkilkdpdslaqcgvrdgltvhlvikrqhramg

    Sequence, based on observed residues (ATOM records): (download) 
    >1yqbA (A:)
sglvprgsphlikvtvktpkdkedfsvtdtctiqqlkeeisqrfkahpdqlvlifagkil
kdpdslaqcgvrdgltvhlvikrqhram