PDB entry 1yqa

View 1yqa on RCSB PDB site
Description: Engineering the structural stability and functional properties of the GI domain into the intrinsically unfolded GII domain of the yeast linker histone Hho1p
Class: DNA binding protein
Keywords: Winged-helix, DNA BINDING PROTEIN
Deposited on 2005-02-01, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HHO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53551 (0-86)
      • engineered (39-45)
    Domains in SCOPe 2.06: d1yqaa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yqaA (A:)
    kasspssltykemilksmpqlndgkgssrivlkkyvkdtypivgsasnfdylfnsaikkc
    vengelvqpkgpsgiiklnkkkvklst