PDB entry 1yqa

View 1yqa on RCSB PDB site
Description: Engineering the structural stability and functional properties of the GI domain into the intrinsically unfolded GII domain of the yeast linker histone Hho1p
Class: DNA binding protein
Keywords: Winged-helix, DNA BINDING PROTEIN
Deposited on 2005-02-01, released 2005-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone H1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: HHO1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53551 (0-86)
    • engineered (39-45)
  Domains in SCOPe 2.08: d1yqaa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yqaA (A:)
  kasspssltykemilksmpqlndgkgssrivlkkyvkdtypivgsasnfdylfnsaikkc
  vengelvqpkgpsgiiklnkkkvklst