PDB entry 1yq8

View 1yq8 on RCSB PDB site
Description: PRD1 vertex protein P5
Deposited on 2005-02-01, released 2005-04-26
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.261
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Minor capsid protein
    Species: Enterobacteria phage PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22536 (0-190)
      • see remark 999 (161)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yq8A (A:)
    vvvedsgasfgeslldttsepgkilvkrisggsgitvtdygdqveieasvtdalslmyst
    stggpasiaanaltdfdlsgaltvnsvgtgltksaagiqlaagksglyqitmtvknntvt
    tgnyllrvkygssdfvvacpassltaggtislliycnvlgvvsldvlkfslcndgaalsn
    yiinitaakin