PDB entry 1yq7

View 1yq7 on RCSB PDB site
Description: Human farnesyl diphosphate synthase complexed with risedronate
Class: transferase
Keywords: isoprenoid pathway, cholesterol biosynthesis, bisphosphonate inhibitor, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2005-02-01, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDPS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yq7a_
  • Heterogens: MG, PO4, RIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yq7A (A:)
    gsshhhhhhssgrenlyfqghmngdqnsdvyaqekqdfvqhfsqivrvltedemghpeig
    daiarlkevleynaiggkynrgltvvvafrelveprkqdadslqrawtvgwcvellqaff
    lvaddimdssltrrgqicwyqkpgvgldaindanlleaciyrllklycreqpyylnliel
    flqssyqteigqtldlltapqgnvdlvrftekryksivkyktafysfylpiaaamymagi
    dgekehanakkillemgeffqiqddyldlfgdpsvtgkigtdiqdnkcswlvvqclqrat
    peqyqilkenygqkeaekvarvkalyeeldlpavflqyeedsyshimalieqyaaplppa
    vflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq7A (A:)
    ekqdfvqhfsqivrvltedepeigdaiarlkevleynaiggkynrgltvvvafrelvepr
    kqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldaindanll
    eaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrftekryks
    ivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlfgdpsvt
    gkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeldlpavfl
    qyeedsyshimalieqyaaplppavflglarkiy