PDB entry 1yq6

View 1yq6 on RCSB PDB site
Description: PRD1 vertex protein P5
Deposited on 2005-02-01, released 2005-04-26
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.245
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Minor capsid protein
    Species: Enterobacteria phage PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22536 (0-143)
      • modified residue (9)
      • modified residue (64)
      • see remark 999 (114)
  • Chain 'B':
    Compound: Minor capsid protein
    Species: Enterobacteria phage PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22536 (0-143)
      • modified residue (9)
      • modified residue (64)
      • see remark 999 (114)
  • Chain 'C':
    Compound: Minor capsid protein
    Species: Enterobacteria phage PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22536 (0-143)
      • modified residue (9)
      • modified residue (64)
      • see remark 999 (114)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yq6A (A:)
    ggvtdalslmyststggpasiaanaltdfdlsgaltvnsvgtgltksaagiqlaagksgl
    yqitmtvknntvttgnyllrvkygssdfvvacpassltaggtislliycnvlgvvsldvl
    kfslcndgaalsnyiinitaakin
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1yq6B (B:)
    ggvtdalslmyststggpasiaanaltdfdlsgaltvnsvgtgltksaagiqlaagksgl
    yqitmtvknntvttgnyllrvkygssdfvvacpassltaggtislliycnvlgvvsldvl
    kfslcndgaalsnyiinitaakin
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1yq6C (C:)
    ggvtdalslmyststggpasiaanaltdfdlsgaltvnsvgtgltksaagiqlaagksgl
    yqitmtvknntvttgnyllrvkygssdfvvacpassltaggtislliycnvlgvvsldvl
    kfslcndgaalsnyiinitaakin