PDB entry 1yq4

View 1yq4 on RCSB PDB site
Description: Avian respiratory complex ii with 3-nitropropionate and ubiquinone
Class: oxidoreductase
Keywords: complex II, membrane protein, heme protein, iron sulfur protein, cytochrome b, oxidoreductase, redox enzyme, respiratory chain, oxaloacetate nitropropionate ubiquinone
Deposited on 2005-02-01, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate dehydrogenase flavoprotein subunit
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • GB XP_419054 (70-620)
  • Chain 'B':
    Compound: succinate dehydrogenase Ip subunit
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • GB AAC72372
    Domains in SCOPe 2.07: d1yq4b1, d1yq4b2
  • Chain 'C':
    Compound: Succinate dehydrogenase cytochrome B, large subunit
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YQ4 (Start-140)
    Domains in SCOPe 2.07: d1yq4c_
  • Chain 'D':
    Compound: Succinate dehydrogenase cytochrome B, small subunit
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • GB NP_001006321 (Start-102)
    Domains in SCOPe 2.07: d1yq4d_
  • Heterogens: FAD, 3NP, FES, SF4, F3S, GOL, JZR, HEM, UQ, PEE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yq4B (B:)
    aqtaaaatsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstlt
    frrscregicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpdlsnfya
    qyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwngdkylg
    pavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgkaiaeikk
    mmatykekaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq4B (B:)
    aatsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrsc
    regicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpdlsnfyaqyksi
    epylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwngdkylgpavlm
    qayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgkaiaeikkmmaty
    ke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yq4C (C:)
    mattakeemarfwekntkssrplsphisiykwslpmamsithrgtgvalslgvslfslaa
    lllpeqfphyvavvkslslspaliysakfalvfplsyhtwngirhlvwdmgkgfklsqve
    qsgvvvliltllssagiaais
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq4C (C:)
    attakeemarfwekntkssrplsphisiykwslpmamsithrgtgvalslgvslfslaal
    llpeqfphyvavvkslslspaliysakfalvfplsyhtwngirhlvwdmgkgfklsqveq
    sgvvvliltllssagiaais
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yq4D (D:)
    gsskaaslhwtseravsalllgllpaaylypgpavdyslaaaltlhghwglgqvitdyvh
    gdtpikvantglyvlsaitftglcyfnyydvgickavamlwsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq4D (D:)
    sskaaslhwtseravsalllgllpaaylypgpavdyslaaaltlhghwglgqvitdyvhg
    dtpikvantglyvlsaitftglcyfnyydvgickavamlwsi