PDB entry 1yq2

View 1yq2 on RCSB PDB site
Description: beta-galactosidase from Arthrobacter sp. C2-2 (isoenzyme C2-2-1)
Class: hydrolase
Keywords: glycosyl hydrolase family 2; tim barrel; hexamer
Deposited on 2005-02-01, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Arthrobacter sp. C2-2
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KRF6 (Start-1023)
      • engineered (903)
    Domains in SCOP 1.73: d1yq2a1, d1yq2a2, d1yq2a3, d1yq2a4, d1yq2a5
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Arthrobacter sp. C2-2
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KRF6 (Start-1023)
      • engineered (903)
    Domains in SCOP 1.73: d1yq2b1, d1yq2b2, d1yq2b3, d1yq2b4, d1yq2b5
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Arthrobacter sp. C2-2
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KRF6 (Start-1023)
      • engineered (903)
    Domains in SCOP 1.73: d1yq2c1, d1yq2c2, d1yq2c3, d1yq2c4, d1yq2c5
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Arthrobacter sp. C2-2
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KRF6 (Start-1023)
      • engineered (903)
    Domains in SCOP 1.73: d1yq2d1, d1yq2d2, d1yq2d3, d1yq2d4, d1yq2d5
  • Chain 'E':
    Compound: beta-galactosidase
    Species: Arthrobacter sp. C2-2
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KRF6 (Start-1023)
      • engineered (903)
    Domains in SCOP 1.73: d1yq2e1, d1yq2e2, d1yq2e3, d1yq2e4, d1yq2e5
  • Chain 'F':
    Compound: beta-galactosidase
    Species: Arthrobacter sp. C2-2
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KRF6 (Start-1023)
      • engineered (903)
    Domains in SCOP 1.73: d1yq2f1, d1yq2f2, d1yq2f3, d1yq2f4, d1yq2f5
  • Heterogens: MG, NA, CL, SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yq2A (A:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2A (A:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yq2B (B:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2B (B:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yq2C (C:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2C (C:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yq2D (D:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2D (D:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yq2E (E:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2E (E:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yq2F (F:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2F (F:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa