PDB entry 1yq2

View 1yq2 on RCSB PDB site
Description: beta-galactosidase from Arthrobacter sp. C2-2 (isoenzyme C2-2-1)
Class: hydrolase
Keywords: glycosyl hydrolase family 2; tim barrel; hexamer
Deposited on 2005-02-01, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yq2A (A:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2A (A:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yq2B (B:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2B (B:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yq2C (C:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2C (C:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yq2D (D:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2D (D:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yq2E (E:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2E (E:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yq2F (F:)
    hmttadvsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlps
    getvegvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptg
    dfrrrfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalra
    gsnllvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagt
    gtidpeitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvss
    aaesisvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkr
    fnvnairtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvd
    rmertverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvy
    srmyssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyeal
    vdkyprlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptp
    glyefkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaa
    egsdgplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapa
    vptrsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfga
    ygpgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsv
    aveenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsm
    hatmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfs
    larhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklr
    ispa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq2F (F:)
    advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
    egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
    rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
    lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpaggitdawlrtgwsarsgagtgtid
    peitadatafpvtlsvpelgvnvtwksaeevaplalenvepwsaevprlyeasvssaaes
    isvrlgfrtvrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvn
    airtshypphprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmer
    tverdknhpsivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmy
    ssipetdsigrndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdky
    prlhggfvwewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglye
    fkqivspirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsd
    gplragesatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavptr
    sprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgaygpg
    dpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvavee
    nwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmhatm
    varhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfslarh
    taqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklrispa