PDB entry 1yq1

View 1yq1 on RCSB PDB site
Description: Structural Genomics Of Caenorhabditis Elegans: glutathione S-Transferase
Class: transferase
Keywords: glutathione S-transferase; nematoda, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2005-01-31, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.224
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: gst-16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93698 (0-End)
      • modified residue (0)
      • modified residue (33)
      • modified residue (48)
    Domains in SCOPe 2.07: d1yq1a1, d1yq1a2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: gst-16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93698 (0-End)
      • modified residue (0)
      • modified residue (33)
      • modified residue (48)
    Domains in SCOPe 2.07: d1yq1b1, d1yq1b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yq1A (A:)
    mpsykltyfffrglgepirllfhlagvqfeevrmnpdqtwldikdstpmkqlpvlnidgf
    elpqsgailrylarkfgfagktpeeeawvdavhdlfkdflaefkkfaaerrsgksaeeve
    kfrsefflparntyfnilnglleksnsgfligsditfadlvvvdnlltlknyglfdesef
    tklaalrekvnsypgikeyiakrpvtey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq1A (A:)
    mpsykltyfffrglgepirllfhlagvqfeevrmnpdqtwldikdstpmkqlpvlnidgf
    elpqsgailrylarkfgfagktpeeeawvdavhdlfkdflaefkkfaaerrsgevekfrs
    efflparntyfnilnglleksnsgfligsditfadlvvvdnlltlknyglfdeseftkla
    alrekvnsypgikeyiakrpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yq1B (B:)
    mpsykltyfffrglgepirllfhlagvqfeevrmnpdqtwldikdstpmkqlpvlnidgf
    elpqsgailrylarkfgfagktpeeeawvdavhdlfkdflaefkkfaaerrsgksaeeve
    kfrsefflparntyfnilnglleksnsgfligsditfadlvvvdnlltlknyglfdesef
    tklaalrekvnsypgikeyiakrpvtey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yq1B (B:)
    mpsykltyfffrglgepirllfhlagvqfeevrmnpdqtwldikdstpmkqlpvlnidgf
    elpqsgailrylarkfgfagktpeeeawvdavhdlfkdflaefkkfaaerrsgevekfrs
    efflparntyfnilnglleksnsgfligsditfadlvvvdnlltlknyglfdeseftkla
    alrekvnsypgikeyiakrpv