PDB entry 1ypy

View 1ypy on RCSB PDB site
Description: crystal structure of vaccinia virus l1 protein
Deposited on 2005-01-31, released 2005-03-01
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virion membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Virion membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ypyA (A:)
    gaaasiqttvntlserisskleqeanasaqtkcdieignfyirqnhgcnltvknmcsada
    daqldavlsaatetysgltpeqkayvpamftaalniqtsvntvvrdfenyvkqtcnssav
    vdnklkiqnviidecygapgsptnlefintgsskgncaikalmqlttkattqiapkqvag
    tgvq
    

    Sequence, based on observed residues (ATOM records):
    >1ypyA (A:)
    aasiqttvntlserisskleqeanasaqtkcdieignfyirqnhgcnltvknmcsadada
    qldavlsaatetysgltpeqkayvpamftaalniqtsvntvvrdfenyvkqtcnssavvd
    nklkiqnviidecygapgsptnlefintgsskgncaikalmqlttkattqiapkqvagtg
    vq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ypyB (B:)
    gaaasiqttvntlserisskleqeanasaqtkcdieignfyirqnhgcnltvknmcsada
    daqldavlsaatetysgltpeqkayvpamftaalniqtsvntvvrdfenyvkqtcnssav
    vdnklkiqnviidecygapgsptnlefintgsskgncaikalmqlttkattqiapkqvag
    tgvq
    

    Sequence, based on observed residues (ATOM records):
    >1ypyB (B:)
    asiqttvntlserisskleqeanasaqtkcdieignfyirqnhgcnltvknmcsadadaq
    ldavlsaatetysgltpeqkayvpamftaalniqtsvntvvrdfenyvkqtcnssavvdn
    klkiqnviidecygapgsptnlefintgsskgncaikalmqlttkatt