PDB entry 1ypx

View 1ypx on RCSB PDB site
Description: crystal structure of the putative vitamin-b12 independent methionine synthase from listeria monocytogenes, northeast structural genomics target lmr13
Deposited on 2005-01-31, released 2005-02-08
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative vitamin-B12 independent methionine synthase family protein
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: 985330
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y8Q1 (Start-366)
      • modified residue (141)
      • modified residue (231)
      • modified residue (235)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ypxA (A:)
    mnqvapfyadhvgsilrtkgikdarekfqsgeitalelrkienteikyivekqkevglks
    itdgefrrawwhfdflenldgvegydaaggiqfskvqtkshsvkitgpidftthpfiedf
    iflkeavgdnhvakqtipspamlhyrgdieyqpylddaekfandlatayqkaiqafydag
    crylqlddtswsylcsdeqrevvrqrgfdpetlqetyknlineaikhkpadmvitmhicr
    gnfrstwiaeggygpvaetlfgklnidgffleydnersgdfaplkyvtrpdlkivlglit
    sktgeledeaaikarieeaseivplsqlrlspqcgfasteegnilteeeqwdklryvvrl
    andiwgelehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ypxA (A:)
    nqvapfyadhvgsilrtkgikdarekfqsgeitalelrkienteikyivekqkevglksi
    tdgefrrwhfdflenldgvegysvkitgpidftthpfiedfiflkeavgdnhvakqtips
    pamlhyrgdieyqpylddaekfandlatayqkaiqafydagcrylqlddtswsylcsdeg
    fdpetlqetyknlineaikhkpadmvitmhicrggygpvaetlfgklnidgffleydner
    faplkyvtrpdlkivlglitsktgeedeaaikarieeaseivplsqlrlspqcgfateee
    qwdklryvvrlandiwge