PDB entry 1ypw

View 1ypw on RCSB PDB site
Description: structure of p97/vcp in complex in adp/amp-pnp
Deposited on 2005-01-31, released 2005-03-22
The last revision was dated 2008-04-22, with a file datestamp of 2008-04-18.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.31
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: MUS MUSCULUS
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: MUS MUSCULUS
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: MUS MUSCULUS
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: MUS MUSCULUS
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, ANP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ypwA (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records):
    >1ypwA (A:)
    lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
    csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylk
    pyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    slnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliar
    avanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekt
    hgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatg
    rleilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledet
    idaevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqyp
    vehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgese
    anvreifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdnvfiiga
    tnrpdiidpailrpgrldqliyiplpdeksrvailkanlrksdvdleflakmtngfsgad
    lteicqracklairespvpeirrdhfeeamrf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ypwB (B:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records):
    >1ypwB (B:)
    lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
    csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylk
    pyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    slnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliar
    avanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekt
    hgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatg
    rleilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledet
    idaevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqyp
    vehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgese
    anvreifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdnvfiiga
    tnrpdiidpailrpgrldqliyiplpdeksrvailkanlrksdvdleflakmtngfsgad
    lteicqracklairespvpeirrdhfeeamrf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1ypwC (C:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records):
    >1ypwC (C:)
    lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
    csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylk
    pyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    slnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliar
    avanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekt
    hgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatg
    rleilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledet
    idaevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqyp
    vehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgese
    anvreifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdnvfiiga
    tnrpdiidpailrpgrldqliyiplpdeksrvailkanlrksdvdleflakmtngfsgad
    lteicqracklairespvpeirrdhfeeamrf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1ypwD (D:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records):
    >1ypwD (D:)
    lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
    csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylk
    pyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    slnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliar
    avanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekt
    hgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatg
    rleilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledet
    idaevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqyp
    vehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgese
    anvreifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdnvfiiga
    tnrpdiidpailrpgrldqliyiplpdeksrvailkanlrksdvdleflakmtngfsgad
    lteicqracklairespvpeirrdhfeeamrf