PDB entry 1ypt

View 1ypt on RCSB PDB site
Description: crystal structure of yersinia protein tyrosine phosphatase at 2.5 angstroms and the complex with tungstate
Deposited on 1994-09-16, released 1994-12-20
The last revision prior to the SCOP 1.69 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ypta_
  • Chain 'B':
    Domains in SCOP 1.69: d1yptb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yptA (A:)
    rerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacgg
    eklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvla
    vlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqkt
    isvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvihc
    ragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqgr
    pllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yptA (A:)
    pearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnanyiq
    vgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgtygs
    itveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkalas
    lvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsqlsve
    dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yptB (B:)
    rerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacgg
    eklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvla
    vlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqkt
    isvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvihc
    ragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqgr
    pllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yptB (B:)
    ygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnany
    iqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgty
    gsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkal
    aslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsqls
    vedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns